Lineage for d6gg9c_ (6gg9 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577189Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2577190Protein automated matches [190492] (24 species)
    not a true protein
  7. 2577346Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries)
  8. 2577349Domain d6gg9c_: 6gg9 C: [355167]
    Other proteins in same PDB: d6gg9a2
    automated match to d5j3wa_
    complexed with fmn; mutant

Details for d6gg9c_

PDB Entry: 6gg9 (more details), 2.04 Å

PDB Description: crystal structures of a short blue light photoreceptor protein ppsb1- lov mutant (dark state) - r61h/r66i
PDB Compounds: (C:) Sensory box protein

SCOPe Domain Sequences for d6gg9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gg9c_ d.110.3.0 (C:) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd
hdqlgiarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs
rqvelerelaelra

SCOPe Domain Coordinates for d6gg9c_:

Click to download the PDB-style file with coordinates for d6gg9c_.
(The format of our PDB-style files is described here.)

Timeline for d6gg9c_: