Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries) |
Domain d6gg9c_: 6gg9 C: [355167] Other proteins in same PDB: d6gg9a2 automated match to d5j3wa_ complexed with fmn; mutant |
PDB Entry: 6gg9 (more details), 2.04 Å
SCOPe Domain Sequences for d6gg9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gg9c_ d.110.3.0 (C:) automated matches {Pseudomonas putida [TaxId: 160488]} minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd hdqlgiarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs rqvelerelaelra
Timeline for d6gg9c_:
View in 3D Domains from other chains: (mouse over for more information) d6gg9a1, d6gg9a2, d6gg9b_, d6gg9d_ |