Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:1420013] [355025] (1 PDB entry) |
Domain d5wewb1: 5wew B:1-139 [355060] Other proteins in same PDB: d5wewa2, d5wewb2, d5wewg2, d5wewh2 automated match to d5v91a_ complexed with a81, mn |
PDB Entry: 5wew (more details), 3.18 Å
SCOPe Domain Sequences for d5wewb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wewb1 d.32.1.0 (B:1-139) automated matches {Klebsiella pneumoniae [TaxId: 1420013]} mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla qrlaacreqpykgmvffeq
Timeline for d5wewb1: