Lineage for d5wewb1 (5wew B:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942942Species Klebsiella pneumoniae [TaxId:1420013] [355025] (1 PDB entry)
  8. 2942944Domain d5wewb1: 5wew B:1-139 [355060]
    Other proteins in same PDB: d5wewa2, d5wewb2, d5wewg2, d5wewh2
    automated match to d5v91a_
    complexed with a81, mn

Details for d5wewb1

PDB Entry: 5wew (more details), 3.18 Å

PDB Description: crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound
PDB Compounds: (B:) Fosfomycin resistance protein

SCOPe Domain Sequences for d5wewb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wewb1 d.32.1.0 (B:1-139) automated matches {Klebsiella pneumoniae [TaxId: 1420013]}
mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
qrlaacreqpykgmvffeq

SCOPe Domain Coordinates for d5wewb1:

Click to download the PDB-style file with coordinates for d5wewb1.
(The format of our PDB-style files is described here.)

Timeline for d5wewb1: