Lineage for d5wg8a_ (5wg8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604178Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 2604179Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries)
    Uniprot P53041 176-499
  8. 2604197Domain d5wg8a_: 5wg8 A: [354993]
    automated match to d1s95b_
    complexed with lb1, mn, mpd, mrd

Details for d5wg8a_

PDB Entry: 5wg8 (more details), 1.65 Å

PDB Description: structure of pp5c with lb-100; 7-oxabicyclo[2.2.1]heptane-2,3- dicarbonyl moiety modeled in the density
PDB Compounds: (A:) Serine/threonine-protein phosphatase 5

SCOPe Domain Sequences for d5wg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wg8a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
iedeysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettl
ketekitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkl
lypdhfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlim
hgglfsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvt
kafleennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrp
qfhqftavphpnvkpmayan

SCOPe Domain Coordinates for d5wg8a_:

Click to download the PDB-style file with coordinates for d5wg8a_.
(The format of our PDB-style files is described here.)

Timeline for d5wg8a_: