SCOPe 2.07: Domain d6alac1: 6ala C:53-198

Lineage for d6alac1 (6ala C:53-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)

6. Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries)

8. Domain d6alac1: 6ala C:53-198 [354923]
   automated match to d1sdwa1
   complexed with cu, flc, gol

Details for d6alac1

PDB Entry: 6ala, 2.59 Å

PDB Description: crystal structure of h108a peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with citrate

PDB Compounds: (C:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d6alac1:

Sequence; same for both SEQRES and ATOM records:

>d6alac1 b.121.1.2 (C:53-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhamllf
gcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvlqvh
ygdisafrdnhkdcsgvsvhltrvpq

Timeline for d6alac1:

• d6alac1 is new in SCOPe 2.07-stable
  
• d6alac1 appears in the current release, SCOPe 2.08