Lineage for d5y8ka1 (5y8k A:1-159)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. Protein automated matches [190069] (313 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)
  8. Domain d5y8ka1: 5y8k A:1-159 [354786]
    Other proteins in same PDB: d5y8ka2, d5y8kb2, d5y8kb3
    automated match to d1yb4a1
    complexed with 9on, akr, gol, ser

Details for d5y8ka1

PDB Entry: 5y8k (more details), 2.04 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8ka1 c.2.1.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaeadv
vitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvsg
gvkgaaaatlafmvggdestlrrarpvlepmagkiihcg

SCOPe Domain Coordinates for d5y8ka1 are not available.

Timeline for d5y8ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y8ka2
View in 3D
Domains from other chains:
(mouse over for more information)
d5y8kb1, d5y8kb2, d5y8kb3