Lineage for d6gfzg_ (6gfz G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931313Domain d6gfzg_: 6gfz G: [354571]
    Other proteins in same PDB: d6gfzb1, d6gfzb2, d6gfzc_, d6gfze1, d6gfze2, d6gfzf_, d6gfzh1, d6gfzh2, d6gfzi_, d6gfzk1, d6gfzk2, d6gfzl_
    automated match to d1lqba_
    complexed with exe

Details for d6gfzg_

PDB Entry: 6gfz (more details), 2.3 Å

PDB Description: pvhl:elob:eloc in complex with modified vh032 containing (3s,4s)-3- fluoro-4-hydroxyproline (ligand 14b)
PDB Compounds: (G:) Elongin-B

SCOPe Domain Sequences for d6gfzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfzg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6gfzg_:

Click to download the PDB-style file with coordinates for d6gfzg_.
(The format of our PDB-style files is described here.)

Timeline for d6gfzg_: