| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
| Protein Cysteine dioxygenase type I [141616] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [159290] (15 PDB entries) Uniprot Q16878 6-190 |
| Domain d6bpsa_: 6bps A: [354386] automated match to d6bgfa_ complexed with cys, f2y, fe2, gol, so4 |
PDB Entry: 6bps (more details), 2.1 Å
SCOPe Domain Sequences for d6bpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bpsa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
evlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkserv
lrenqcayindsvglhrvenishtepavslhlxsppfdtchafdqrtghknkvtmtfhsk
fgirtp
Timeline for d6bpsa_: