SCOPe 2.08: Domain d5xx6a_: 5xx6 A:

Lineage for d5xx6a_ (5xx6 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)

8. Domain d5xx6a_: 5xx6 A: [354338]
   automated match to d2zvxa_
   complexed with so4

Details for d5xx6a_

PDB Entry: 5xx6, 1.31 Å

PDB Description: hetero-micro-seeding: crystal structure of bpti-[5,55]c14ga38i variant using micro-seeds from -c14ga38g variant

PDB Compounds: (A:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5xx6a_:

Sequence; same for both SEQRES and ATOM records:

>d5xx6a_ g.8.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpgkariiryfynakaglaqtfvyggirakrnnfksaedalrtcgga

Timeline for d5xx6a_:

• d5xx6a_ first appeared in SCOPe 2.07