Lineage for d5xjrf_ (5xjr F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397156Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)
  8. 2397228Domain d5xjrf_: 5xjr F: [354296]
    Other proteins in same PDB: d5xjra_, d5xjrb_
    automated match to d4f7ui_

Details for d5xjrf_

PDB Entry: 5xjr (more details), 3.12 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2dn39 in complex with smd1(1-82)/d2/f/e/g from human
PDB Compounds: (F:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d5xjrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjrf_ b.38.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
lircnnvlyirgve

SCOPe Domain Coordinates for d5xjrf_:

Click to download the PDB-style file with coordinates for d5xjrf_.
(The format of our PDB-style files is described here.)

Timeline for d5xjrf_: