| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
| Protein automated matches [190914] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries) |
| Domain d5xjrf_: 5xjr F: [354296] Other proteins in same PDB: d5xjra_, d5xjrb_ automated match to d4f7ui_ |
PDB Entry: 5xjr (more details), 3.12 Å
SCOPe Domain Sequences for d5xjrf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjrf_ b.38.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
lircnnvlyirgve
Timeline for d5xjrf_:
View in 3DDomains from other chains: (mouse over for more information) d5xjra_, d5xjrb_, d5xjre_, d5xjrg_ |