Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
Protein Phosphoglucomutase [53740] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
Domain d1jdya3: 1jdy A:304-420 [35428] Other proteins in same PDB: d1jdya4, d1jdyb4 |
PDB Entry: 1jdy (more details), 2.7 Å
SCOP Domain Sequences for d1jdya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdya3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d1jdya3:
View in 3D Domains from other chains: (mouse over for more information) d1jdyb1, d1jdyb2, d1jdyb3, d1jdyb4 |