Lineage for d1jdya3 (1jdy A:304-420)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402703Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 402704Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 402705Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 402720Protein Phosphoglucomutase [53740] (1 species)
  7. 402721Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 402742Domain d1jdya3: 1jdy A:304-420 [35428]
    Other proteins in same PDB: d1jdya4, d1jdyb4

Details for d1jdya3

PDB Entry: 1jdy (more details), 2.7 Å

PDB Description: rabbit muscle phosphoglucomutase

SCOP Domain Sequences for d1jdya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdya3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOP Domain Coordinates for d1jdya3:

Click to download the PDB-style file with coordinates for d1jdya3.
(The format of our PDB-style files is described here.)

Timeline for d1jdya3: