Lineage for d6bpxa_ (6bpx A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. Protein Cysteine dioxygenase type I [141616] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [159290] (15 PDB entries)
    Uniprot Q16878 6-190
  8. Domain d6bpxa_: 6bpx A: [354258]
    automated match to d6bgfa_
    complexed with 2lt, cys, fe2, gol, so4

Details for d6bpxa_

PDB Entry: 6bpx (more details), 2.15 Å

PDB Description: crystal structure of cysteine-bound ferrous form of the matured cl2- tyr157 human cysteine dioxygenase
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d6bpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bpxa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
evlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkserv
lrenqcayindsvglhrvenishtepavslhlxsppfdtchafdqrtghknkvtmtfhsk
fgirtpn

SCOPe Domain Coordinates for d6bpxa_ are not available.

Timeline for d6bpxa_: