SCOPe 2.08: Domain d5w7tb1: 5w7t B:210-482

Lineage for d5w7tb1 (5w7t B:210-482)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase wnk1 [111196] (2 species)
   OPK group; WNK subfamily; serine/threonine kinase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [419788] (4 PDB entries)

8. Domain d5w7tb1: 5w7t B:210-482 [353778]
   Other proteins in same PDB: d5w7ta2, d5w7tb2
   automated match to d4pwna_
   complexed with anp, sep

Details for d5w7tb1

PDB Entry: 5w7t, 2.01 Å

PDB Description: structure of phosphorylated wnk1

PDB Compounds: (B:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d5w7tb1:

Sequence; same for both SEQRES and ATOM records:

>d5w7tb1 d.144.1.7 (B:210-482) Protein kinase wnk1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef
mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
pevkeiiegcirqnkderysikdllnhaffqee

Timeline for d5w7tb1:

• d5w7tb1 first appeared in SCOPe 2.07