Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase wnk1 [111196] (2 species) OPK group; WNK subfamily; serine/threonine kinase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [419788] (4 PDB entries) |
Domain d5w7tb1: 5w7t B:210-482 [353778] Other proteins in same PDB: d5w7ta2, d5w7tb2 automated match to d4pwna_ complexed with anp, sep |
PDB Entry: 5w7t (more details), 2.01 Å
SCOPe Domain Sequences for d5w7tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w7tb1 d.144.1.7 (B:210-482) Protein kinase wnk1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai pevkeiiegcirqnkderysikdllnhaffqee
Timeline for d5w7tb1: