PDB entry 5w7t

View 5w7t on RCSB PDB site
Description: structure of phosphorylated wnk1
Class: transferase
Keywords: transferase
Deposited on 2017-06-20, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Wnk1, Hsn2, Prkwnk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIH7 (4-276)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5w7ta1, d5w7ta2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Wnk1, Hsn2, Prkwnk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIH7 (4-276)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5w7tb1, d5w7tb2
  • Heterogens: ANP, SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w7tA (A:)
    gamdkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrf
    keeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlr
    swcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvig
    tpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfd
    kvaipevkeiiegcirqnkderysikdllnhaffqee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w7tB (B:)
    gamdkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrf
    keeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlr
    swcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvig
    tpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfd
    kvaipevkeiiegcirqnkderysikdllnhaffqee