Lineage for d5o6ra_ (5o6r A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2526948Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2526949Protein beta-Phosphoglucomutase [75174] (3 species)
  7. 2526981Species Lactococcus lactis [TaxId:272623] [341074] (27 PDB entries)
  8. 2526994Domain d5o6ra_: 5o6r A: [353749]
    automated match to d1o08a_
    complexed with alf, mg, xgp; mutant

Details for d5o6ra_

PDB Entry: 5o6r (more details), 1.36 Å

PDB Description: structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1-phosphate and aluminium tetrafluoride
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d5o6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o6ra_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 272623]}
mfkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlq

SCOPe Domain Coordinates for d5o6ra_:

Click to download the PDB-style file with coordinates for d5o6ra_.
(The format of our PDB-style files is described here.)

Timeline for d5o6ra_: