Lineage for d1bpwd_ (1bpw D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140679Species Baltic cod (Gadus callarias) [TaxId:8053] [53728] (2 PDB entries)
  8. 2140687Domain d1bpwd_: 1bpw D: [35368]
    complexed with nad

Details for d1bpwd_

PDB Entry: 1bpw (more details), 2.8 Å

PDB Description: betaine aldehyde dehydrogenase from cod liver
PDB Compounds: (D:) protein (aldehyde dehydrogenase)

SCOPe Domain Sequences for d1bpwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpwd_ c.82.1.1 (D:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]}
aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
atvdyysqlktvivemgdvdslf

SCOPe Domain Coordinates for d1bpwd_:

Click to download the PDB-style file with coordinates for d1bpwd_.
(The format of our PDB-style files is described here.)

Timeline for d1bpwd_: