PDB entry 1bpw

View 1bpw on RCSB PDB site
Description: betaine aldehyde dehydrogenase from cod liver
Class: oxidoreductase
Keywords: oxidoreductase, aldehyde oxidation, nad complex
Deposited on 1998-08-12, released 1998-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aldehyde dehydrogenase)
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpwa_
  • Chain 'B':
    Compound: protein (aldehyde dehydrogenase)
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpwb_
  • Chain 'C':
    Compound: protein (aldehyde dehydrogenase)
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpwc_
  • Chain 'D':
    Compound: protein (aldehyde dehydrogenase)
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpwd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bpwA (A:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bpwB (B:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bpwC (C:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bpwD (D:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf