Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (61 species) not a true protein |
Species Acinetobacter baumannii [TaxId:405416] [340181] (9 PDB entries) |
Domain d5zzca_: 5zzc A: [353601] automated match to d5yh7a_ complexed with cl, cod, mg |
PDB Entry: 5zzc (more details), 1.96 Å
SCOPe Domain Sequences for d5zzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zzca_ c.26.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 405416]} msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
Timeline for d5zzca_: