PDB entry 5zzc

View 5zzc on RCSB PDB site
Description: Crystal structure of the complex of Phosphopantetheine adenylyltransferase from Acinetobacter baumannii with Dephospho Coenzyme A at 1.94A resolution
Class: transferase
Keywords: transferase
Deposited on 2018-05-31, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Acinetobacter baumannii (strain ACICU) [TaxId:405416]
    Gene: coaD, ACICU_00798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zzca_
  • Heterogens: MG, COD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5zzcA (A:)
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw