Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Escherichia coli [TaxId:562] [187306] (111 PDB entries) |
Domain d6bu3a_: 6bu3 A: [353484] automated match to d1ylpa_ complexed with 3gk, so4 |
PDB Entry: 6bu3 (more details), 1.15 Å
SCOPe Domain Sequences for d6bu3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bu3a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset qkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp qqnaesrrdvlasaariiaegl
Timeline for d6bu3a_: