Lineage for d6bu3a_ (6bu3 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187306] (109 PDB entries)
  8. Domain d6bu3a_: 6bu3 A: [353484]
    automated match to d1ylpa_
    complexed with 3gk, so4

Details for d6bu3a_

PDB Entry: 6bu3 (more details), 1.1500000000000001 Å

PDB Description: ctx-m-27 beta-lactamase in complex with a non-covalent tetrazole inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6bu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bu3a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikhadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsggygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d6bu3a_ are not available.

Timeline for d6bu3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6bu3b_