SCOPe 2.08: Domain d6bz4a2: 6bz4 A:340-443

Lineage for d6bz4a2 (6bz4 A:340-443)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6bz4a2: 6bz4 A:340-443 [353427]
   automated match to d3d6ga2
   complexed with edo; mutant

Details for d6bz4a2

PDB Entry: 6bz4, 2.4 Å

PDB Description: human igg1 lacking complement-dependent cytotoxicity: hu3s193 fc mutant k322a

PDB Compounds: (A:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d6bz4a2:

Sequence; same for both SEQRES and ATOM records:

>d6bz4a2 b.1.1.2 (A:340-443) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d6bz4a2:

• d6bz4a2 first appeared in SCOPe 2.07