PDB entry 6bz4

View 6bz4 on RCSB PDB site
Description: Human IgG1 lacking complement-dependent cytotoxicity: hu3S193 Fc mutant K322A
Class: immune system
Keywords: Immunoglobulin G, Fc engineering, complement dependent cytotoxicity, IMMUNE SYSTEM
Deposited on 2017-12-22, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-End)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d6bz4a1, d6bz4a2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-207)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d6bz4b1, d6bz4b2
  • Heterogens: NAG, BMA, MAN, FUC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bz4A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykcavsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bz4A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykcavsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6bz4B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykcavsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bz4B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstvvsvltvlhqdwlngkeykcavsnkalpapiektiskakgqprepqvytlppsrdel
    tknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwq
    qgnvfscsvmhealhnhytqkslsls