Lineage for d6fujb_ (6fuj B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405098Protein Factor D [50563] (1 species)
  7. 2405099Species Human (Homo sapiens) [TaxId:9606] [50564] (24 PDB entries)
  8. 2405129Domain d6fujb_: 6fuj B: [353375]
    automated match to d1bioa_
    complexed with e8b

Details for d6fujb_

PDB Entry: 6fuj (more details), 2.25 Å

PDB Description: complement factor d in complex with the inhibitor n-(3'-(aminomethyl)- [1,1'-biphenyl]-3-yl)-3-methylbutanamide
PDB Compounds: (B:) complement factor d

SCOPe Domain Sequences for d6fujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fujb_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6fujb_:

Click to download the PDB-style file with coordinates for d6fujb_.
(The format of our PDB-style files is described here.)

Timeline for d6fujb_: