Lineage for d5y12a1 (5y12 A:0-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804864Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
    Uniprot P15090
  8. 2804893Domain d5y12a1: 5y12 A:0-131 [353371]
    Other proteins in same PDB: d5y12a2
    automated match to d5bvqa_
    complexed with 8jx

Details for d5y12a1

PDB Entry: 5y12 (more details), 1.75 Å

PDB Description: crystal structure of human fabp4 complexed with ligand 5-((4- methoxynaphthalene)-1-sulfonamido)pentanoic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5y12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y12a1 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d5y12a1:

Click to download the PDB-style file with coordinates for d5y12a1.
(The format of our PDB-style files is described here.)

Timeline for d5y12a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y12a2