SCOPe 2.08: Domain d5y12a1: 5y12 A:0-131

Lineage for d5y12a1 (5y12 A:0-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
   Uniprot P15090

8. Domain d5y12a1: 5y12 A:0-131 [353371]
   Other proteins in same PDB: d5y12a2
   automated match to d5bvqa_
   complexed with 8jx

Details for d5y12a1

PDB Entry: 5y12, 1.75 Å

PDB Description: crystal structure of human fabp4 complexed with ligand 5-((4- methoxynaphthalene)-1-sulfonamido)pentanoic acid

PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5y12a1:

Sequence; same for both SEQRES and ATOM records:

>d5y12a1 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

Timeline for d5y12a1:

• d5y12a1 first appeared in SCOPe 2.07