Lineage for d5y0fa1 (5y0f A:0-131)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
    Uniprot P15090
  8. Domain d5y0fa1: 5y0f A:0-131 [353327]
    Other proteins in same PDB: d5y0fa2
    automated match to d5bvqa_
    complexed with 8jo

Details for d5y0fa1

PDB Entry: 5y0f (more details), 1.54 Å

PDB Description: crystal structure of human fabp4 complexed with ligand 2-fluoro-5-((4- methoxynaphthalene)-1-sulfonamido) benzoic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5y0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y0fa1 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d5y0fa1 are not available.

Timeline for d5y0fa1:

Domains from same chain:
(mouse over for more information)
d5y0fa2