SCOPe 2.07: Domain d5zqxb2: 5zqx B:324-533

Lineage for d5zqxb2 (5zqx B:324-533)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries)

8. Domain d5zqxb2: 5zqx B:324-533 [353078]
   Other proteins in same PDB: d5zqxa1, d5zqxa3, d5zqxb1, d5zqxc1, d5zqxc3, d5zqxd1
   automated match to d3c2ub2
   complexed with bxp; mutant

Details for d5zqxb2

PDB Entry: 5zqx, 2 Å

PDB Description: crystal structure of beta-xylosidase mutant (e186q) from bacillus pumilus

PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d5zqxb2:

Sequence; same for both SEQRES and ATOM records:

>d5zqxb2 b.29.1.0 (B:324-533) automated matches {Bacillus pumilus [TaxId: 1408]}
sptyhivdefkdsslnrhfqtlripftdqigsvtenphhlrlygqesltskftqafvarr
wqsfyfeaetavsffpknfqqaaglvnyyntenwtalqvtyddalgrilelsvcenlafs
qplikkiiipdeipyvylkvtvqretytysysfdqqewekidvplesthlsddfirgggf
ftgafvgmqcqdtsgerlpadfkyfryeet

Timeline for d5zqxb2:

• d5zqxb2 is new in SCOPe 2.07-stable
  
• d5zqxb2 appears in the current release, SCOPe 2.08