Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries) |
Domain d6ci9h1: 6ci9 H:1-252 [353051] Other proteins in same PDB: d6ci9a2, d6ci9b2, d6ci9c2, d6ci9d2, d6ci9e2, d6ci9f2, d6ci9g2, d6ci9h2, d6ci9i2, d6ci9j2, d6ci9k2, d6ci9l2, d6ci9m2, d6ci9n2, d6ci9p2 automated match to d3riha_ complexed with cl, f3v, mg, nap |
PDB Entry: 6ci9 (more details), 1.9 Å
SCOPe Domain Sequences for d6ci9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ci9h1 c.2.1.0 (H:1-252) automated matches {Mycobacterium smegmatis [TaxId: 246196]} mftslegrsaivtggskgigrgiaetfanagvdvvitgrnqddldrtvadlsgtrgkvta vradvtdpedarrtvaetvsrhggldivcanagifpsgrledltpddieqvlgvnfkgtv yivqaalqaltasghgrvvvtssitgpitgypgwshygaskaaqlgflrtaamelapkki tinavlpgnimtegldemgqdyldqmasaipagrlgsvadignaalffatdeaayvtgqt lvvdggqvlpes
Timeline for d6ci9h1:
View in 3D Domains from other chains: (mouse over for more information) d6ci9a1, d6ci9a2, d6ci9b1, d6ci9b2, d6ci9c1, d6ci9c2, d6ci9d1, d6ci9d2, d6ci9e1, d6ci9e2, d6ci9f1, d6ci9f2, d6ci9g1, d6ci9g2, d6ci9i1, d6ci9i2, d6ci9j1, d6ci9j2, d6ci9k1, d6ci9k2, d6ci9l1, d6ci9l2, d6ci9m1, d6ci9m2, d6ci9n1, d6ci9n2, d6ci9o_, d6ci9p1, d6ci9p2 |