Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries) |
Domain d6d7ch_: 6d7c H: [352949] Other proteins in same PDB: d6d7ca_, d6d7cc_, d6d7ce_, d6d7cg_, d6d7ci_, d6d7ck_ automated match to d4d00d_ complexed with nag |
PDB Entry: 6d7c (more details), 2.95 Å
SCOPe Domain Sequences for d6d7ch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d7ch_ h.3.1.1 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
Timeline for d6d7ch_: