Lineage for d6d7ch_ (6d7c H:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646332Domain d6d7ch_: 6d7c H: [352949]
    Other proteins in same PDB: d6d7ca_, d6d7cc_, d6d7ce_, d6d7cg_, d6d7ci_, d6d7ck_
    automated match to d4d00d_
    complexed with nag

Details for d6d7ch_

PDB Entry: 6d7c (more details), 2.95 Å

PDB Description: the crystal structure of hemagglutinin from a/hong kong/61/2016 h7n9 influenza virus
PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6d7ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d7ch_ h.3.1.1 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d6d7ch_:

Click to download the PDB-style file with coordinates for d6d7ch_.
(The format of our PDB-style files is described here.)

Timeline for d6d7ch_: