Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [226352] (3 PDB entries) |
Domain d5nrib2: 5nri B:103-312 [352877] Other proteins in same PDB: d5nria1, d5nrib1 automated match to d4egqb2 complexed with amp, dal, edo, mg, pge, so4 |
PDB Entry: 5nri (more details), 1.5 Å
SCOPe Domain Sequences for d5nrib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nrib2 d.142.1.0 (B:103-312) automated matches {Burkholderia pseudomallei [TaxId: 320372]} dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvk sadalpaaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyi andtqylipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgm tdhslppkaaravgigyselvvkvlsltld
Timeline for d5nrib2: