Lineage for d5nuxa_ (5nux A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437379Species Thermus scotoductus [TaxId:37636] [189238] (3 PDB entries)
  8. 2437388Domain d5nuxa_: 5nux A: [352873]
    automated match to d3hgja_
    complexed with fmn; mutant

Details for d5nuxa_

PDB Entry: 5nux (more details), 2.3 Å

PDB Description: thermus scotoductus sa-01 ene-reductase double mutant tser_c25d_i67t
PDB Compounds: (A:) Chromate reductase

SCOPe Domain Sequences for d5nuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuxa_ c.1.4.0 (A:) automated matches {Thermus scotoductus [TaxId: 37636]}
allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav
eplgrtspydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf

SCOPe Domain Coordinates for d5nuxa_:

Click to download the PDB-style file with coordinates for d5nuxa_.
(The format of our PDB-style files is described here.)

Timeline for d5nuxa_: