SCOPe 2.08: Domain d1bksb_: 1bks B:

Lineage for d1bksb_ (1bks B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)

8. Domain d1bksb_: 1bks B: [35285]
   Other proteins in same PDB: d1bksa_
   complexed with na, plp

Details for d1bksb_

PDB Entry: 1bks, 2.2 Å

PDB Description: tryptophan synthase (e.c.4.2.1.20) from salmonella typhimurium

PDB Compounds: (B:) tryptophan synthase

SCOPe Domain Sequences for d1bksb_:

Sequence; same for both SEQRES and ATOM records:

>d1bksb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkar

Timeline for d1bksb_:

• d1bksb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bksb_ appears in SCOPe 2.07