SCOP 1.59: Domain d1cw2b_: 1cw2 B:

Lineage for d1cw2b_ (1cw2 B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries)

8. Domain d1cw2b_: 1cw2 B: [35278]
   Other proteins in same PDB: d1cw2a_

Details for d1cw2b_

PDB Entry: 1cw2, 2 Å

PDB Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylsulfinyl)-butylphosphonic acid

SCOP Domain Sequences for d1cw2b_:

Sequence; same for both SEQRES and ATOM records:

>d1cw2b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

Timeline for d1cw2b_:

• d1cw2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cw2b_ appears in SCOP 1.57
  
• d1cw2b_ appears in SCOP 1.61
  
• d1cw2b_ appears in the current release, SCOPe 2.08