Lineage for d5ofda1 (5ofd A:7-166)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)
  8. Domain d5ofda1: 5ofd A:7-166 [352571]
    Other proteins in same PDB: d5ofda2
    automated match to d5i6la1
    complexed with cu, no

Details for d5ofda1

PDB Entry: 5ofd (more details), 1.7700000000000002 Å

PDB Description: cu nitrite reductase serial data at varying temperatures 190k 0.48mgy
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5ofda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofda1 b.6.1.3 (A:7-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d5ofda1 are not available.

Timeline for d5ofda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ofda2