SCOPe 2.08: Domain d5ofca1: 5ofc A:7-166

Lineage for d5ofca1 (5ofc A:7-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)

8. Domain d5ofca1: 5ofc A:7-166 [352541]
   Other proteins in same PDB: d5ofca2
   automated match to d5i6la1
   complexed with act, cu, no2

Details for d5ofca1

PDB Entry: 5ofc, 1.68 Å

PDB Description: cu nitrite reductase serial data at varying temperatures 190k 21.65mgy

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5ofca1:

Sequence; same for both SEQRES and ATOM records:

>d5ofca1 b.6.1.3 (A:7-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d5ofca1:

• d5ofca1 first appeared in SCOPe 2.07