Lineage for d2otcd1 (2otc D:1-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156471Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2156472Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)
  8. 2156485Domain d2otcd1: 2otc D:1-150 [35240]
    complexed with pao

Details for d2otcd1

PDB Entry: 2otc (more details), 2.8 Å

PDB Description: ornithine transcarbamoylase complexed with n-(phosphonacetyl)-l-ornithine
PDB Compounds: (D:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d2otcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otcd1 c.78.1.1 (D:1-150) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
rvpvwngltnefhptqlladlltmqehlpg

SCOPe Domain Coordinates for d2otcd1:

Click to download the PDB-style file with coordinates for d2otcd1.
(The format of our PDB-style files is described here.)

Timeline for d2otcd1: