SCOPe 2.07: Domain d5xmoa_: 5xmo A:

Lineage for d5xmoa_ (5xmo A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (9 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [188032] (8 PDB entries)

8. Domain d5xmoa_: 5xmo A: [352285]
   automated match to d2jkwa_
   complexed with cu

Details for d5xmoa_

PDB Entry: 5xmo, 1.19 Å

PDB Description: x-ray crystal structure of pseudoazurin met16phe/thr36lys variant

PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d5xmoa_:

Sequence; same for both SEQRES and ATOM records:

>d5xmoa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgafvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

Timeline for d5xmoa_:

• d5xmoa_ is new in SCOPe 2.07-stable
  
• d5xmoa_ appears in the current release, SCOPe 2.08