Lineage for d1duvg1 (1duv G:1-150)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493314Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 493320Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)
  8. 493321Domain d1duvg1: 1duv G:1-150 [35228]

Details for d1duvg1

PDB Entry: 1duv (more details), 1.7 Å

PDB Description: crystal structure of e. coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn)

SCOP Domain Sequences for d1duvg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duvg1 c.78.1.1 (G:1-150) Ornithine transcarbamoylase {Escherichia coli}
sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
svpvwngltnefhptqlladlltmqehlpg

SCOP Domain Coordinates for d1duvg1:

Click to download the PDB-style file with coordinates for d1duvg1.
(The format of our PDB-style files is described here.)

Timeline for d1duvg1: