SCOPe 2.08: Domain d1duvg1: 1duv G:1-150

Lineage for d1duvg1 (1duv G:1-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)

8. Domain d1duvg1: 1duv G:1-150 [35228]
   complexed with mpd, psq

Details for d1duvg1

PDB Entry: 1duv, 1.7 Å

PDB Description: crystal structure of e. coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn)

PDB Compounds: (G:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1duvg1:

Sequence; same for both SEQRES and ATOM records:

>d1duvg1 c.78.1.1 (G:1-150) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
svpvwngltnefhptqlladlltmqehlpg

Timeline for d1duvg1:

• d1duvg1 first appeared (with stable ids) in SCOP 1.55
  
• d1duvg1 appears in SCOPe 2.07