SCOPe 2.08: Domain d5tx9a1: 5tx9 A:25-315

Lineage for d5tx9a1 (5tx9 A:25-315)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [352201] (11 PDB entries)

8. Domain d5tx9a1: 5tx9 A:25-315 [352202]
   Other proteins in same PDB: d5tx9a2, d5tx9b2
   automated match to d3huna1
   complexed with na, rb6, zn; mutant

Details for d5tx9a1

PDB Entry: 5tx9, 1.68 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (e183a, f241r) in complex with ceftobiprole

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tx9a1:

Sequence; same for both SEQRES and ATOM records:

>d5tx9a1 e.3.1.1 (A:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaansrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytrnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d5tx9a1:

• d5tx9a1 first appeared in SCOPe 2.07