Lineage for d6elad_ (6ela D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964437Domain d6elad_: 6ela D: [352138]
    automated match to d5czma_
    complexed with b9z, ca, dio, edo, zn

Details for d6elad_

PDB Entry: 6ela (more details), 1.49 Å

PDB Description: crystal structure of mmp12 in complex with inhibitor be4.
PDB Compounds: (D:) Macrophage metalloelastase

SCOPe Domain Sequences for d6elad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elad_ d.92.1.11 (D:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptyayvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d6elad_:

Click to download the PDB-style file with coordinates for d6elad_.
(The format of our PDB-style files is described here.)

Timeline for d6elad_: