PDB entry 6ela

View 6ela on RCSB PDB site
Description: Crystal structure of MMP12 in complex with inhibitor BE4.
Class: hydrolase
Keywords: metzincin, carboxylate inhibitor alternative zinc-binding groups, HYDROLASE
Deposited on 2017-09-28, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (Start-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d6elaa_
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d6elab_
  • Chain 'C':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d6elac_
  • Chain 'D':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d6elad_
  • Heterogens: ZN, CA, B9Z, DIO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6elaA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elaA (A:)
    pvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarg
    ahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslgl
    ghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6elaB (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elaB (B:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6elaC (C:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elaC (C:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6elaD (D:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6elaD (D:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptyayvdintfrlsaddirgiqslyg