Lineage for d6enmb_ (6enm B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d6enmb_: 6enm B: [352098]
automated match to d5i43b_
complexed with ca, lpw, zn
Details for d6enmb_
PDB Entry: 6enm (more details), 1.59 Å
PDB Description: crystal structure of mmp12 in complex with hydroxamate inhibitor lp168.
PDB Compounds: (B:) Macrophage metalloelastaseSCOPe Domain Sequences for d6enmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6enmb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
pkavmfptykyvdintfrlsaddirgiqslyg
SCOPe Domain Coordinates for d6enmb_:
Click to download the PDB-style file with coordinates for d6enmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6enmb_:
- d6enmb_ first appeared in SCOPe 2.07
View in 3D
