Lineage for d6ekna1 (6ekn A:106-263)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d6ekna1: 6ekn A:106-263 [352081]
Other proteins in same PDB: d6ekna2
automated match to d5i43b_
complexed with b9n, ca, edo, zn
Details for d6ekna1
PDB Entry: 6ekn (more details), 1.2 Å
PDB Description: crystal structure of mmp12 in complex with inhibitor be7.
PDB Compounds: (A:) Macrophage metalloelastaseSCOPe Domain Sequences for d6ekna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ekna1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg
SCOPe Domain Coordinates for d6ekna1:
Click to download the PDB-style file with coordinates for d6ekna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ekna1:
- d6ekna1 first appeared in SCOPe 2.07
View in 3D
