Lineage for d1dxha1 (1dxh A:1-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156471Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2156514Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)
  8. 2156515Domain d1dxha1: 1dxh A:1-150 [35202]
    complexed with so4

Details for d1dxha1

PDB Entry: 1dxh (more details), 2.5 Å

PDB Description: catabolic ornithine carbamoyltransferase from pseudomonas aeruginosa
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d1dxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxha1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}
afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr
cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaieyrgfkqeiveelakf
agvpvfngltdeyhptqmladvltmrehsd

SCOPe Domain Coordinates for d1dxha1:

Click to download the PDB-style file with coordinates for d1dxha1.
(The format of our PDB-style files is described here.)

Timeline for d1dxha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dxha2