SCOPe 2.08: Domain d5vtaa1: 5vta A:39-509

Lineage for d5vtaa1 (5vta A:39-509)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (8 PDB entries)

8. Domain d5vtaa1: 5vta A:39-509 [352016]
   Other proteins in same PDB: d5vtaa2, d5vtab2, d5vtac2, d5vtad2, d5vtae1, d5vtae2, d5vtaf_, d5vtag_, d5vtah_, d5vtai_, d5vtaj_, d5vtak_, d5vtal1, d5vtal2
   automated match to d2gbca1
   complexed with 9k4, edo, nag, peg, pg4

Details for d5vtaa1

PDB Entry: 5vta, 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5vtaa1:

Sequence; same for both SEQRES and ATOM records:

>d5vtaa1 b.70.3.1 (A:39-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifgd
sisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsqe
ghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspng
tflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsstt
ttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwncp
ttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctfi
tkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqyy
svslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

Timeline for d5vtaa1:

• d5vtaa1 first appeared in SCOPe 2.07