Lineage for d5vtaj_ (5vta J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760709Domain d5vtaj_: 5vta J: [351982]
    Other proteins in same PDB: d5vtaa1, d5vtaa2, d5vtab1, d5vtab2, d5vtac1, d5vtac2, d5vtad1, d5vtad2, d5vtae2, d5vtal2
    automated match to d1igml_
    complexed with 9k4, edo, nag, peg, pg4

Details for d5vtaj_

PDB Entry: 5vta (more details), 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor
PDB Compounds: (J:) Fab light chain

SCOPe Domain Sequences for d5vtaj_:

Sequence, based on SEQRES records: (download)

>d5vtaj_ b.1.1.0 (J:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspailsaspgekvtmtcrasssvcnmhwyqqkpgsspkpwlhgtsnlasgvpvr
fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfggg

Sequence, based on observed residues (ATOM records): (download)

>d5vtaj_ b.1.1.0 (J:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspaikvtmtcrasssvcnmhwyqqkpgsspkpwlhgtsnlasgvpvrfsgsgsg
tsfsltisrveatyfcqqwsnhpptfggg

SCOPe Domain Coordinates for d5vtaj_:

Click to download the PDB-style file with coordinates for d5vtaj_.
(The format of our PDB-style files is described here.)

Timeline for d5vtaj_: