Lineage for d2at2b1 (2at2 B:1-144)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844055Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 844056Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 844057Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 844058Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 844067Species Bacillus subtilis [TaxId:1423] [53675] (1 PDB entry)
  8. 844070Domain d2at2b1: 2at2 B:1-144 [35198]
    CA-atoms only

Details for d2at2b1

PDB Entry: 2at2 (more details), 3 Å

PDB Description: molecular structure of bacillus subtilis aspartate transcarbamoylase at 3.0 angstroms resolution
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOP Domain Sequences for d2at2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at2b1 c.78.1.1 (B:1-144) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]}
mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
gdgcgqhptqslldlmtiyeefnt

SCOP Domain Coordinates for d2at2b1:

Click to download the PDB-style file with coordinates for d2at2b1.
(The format of our PDB-style files is described here.)

Timeline for d2at2b1: