Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
Species Bacillus subtilis [TaxId:1423] [53675] (1 PDB entry) |
Domain d2at2b1: 2at2 B:1-144 [35198] |
PDB Entry: 2at2 (more details), 3 Å
SCOP Domain Sequences for d2at2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2at2b1 c.78.1.1 (B:1-144) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna gdgcgqhptqslldlmtiyeefnt
Timeline for d2at2b1:
View in 3D Domains from other chains: (mouse over for more information) d2at2a1, d2at2a2, d2at2c1, d2at2c2 |