Lineage for d5vsuf_ (5vsu F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787451Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries)
  8. 2787467Domain d5vsuf_: 5vsu F: [351972]
    Other proteins in same PDB: d5vsuc2
    automated match to d4c92f_

Details for d5vsuf_

PDB Entry: 5vsu (more details), 3.1 Å

PDB Description: structure of yeast u6 snrnp with 2'-phosphate terminated u6 rna
PDB Compounds: (F:) U6 snRNA-associated Sm-like protein LSm6

SCOPe Domain Sequences for d5vsuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vsuf_ b.38.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
dvflrgtqvmyiseqki

SCOPe Domain Coordinates for d5vsuf_:

Click to download the PDB-style file with coordinates for d5vsuf_.
(The format of our PDB-style files is described here.)

Timeline for d5vsuf_: