SCOP 1.59: Domain d9atca1: 9atc A:1-150

Lineage for d9atca1 (9atc A:1-150)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d9atca1: 9atc A:1-150 [35188]
   Other proteins in same PDB: d9atcb1, d9atcb2

Details for d9atca1

PDB Entry: 9atc, 2.4 Å

PDB Description: atcase y165f mutant

SCOP Domain Sequences for d9atca1:

Sequence; same for both SEQRES and ATOM records:

>d9atca1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d9atca1:

• d9atca1 first appeared (with stable ids) in SCOP 1.55
  
• d9atca1 appears in SCOP 1.57
  
• d9atca1 appears in SCOP 1.61
  
• d9atca1 appears in the current release, SCOPe 2.08